Loading...
Statistics
Advertisement

Ppmpharma.net

Advertisement
Conversion Technology Metas Server
Ppmpharma.net is hosted in Germany . Ppmpharma.net doesn't use HTTPS protocol. Number of used technologies: 2. First technologies: Html, Javascript, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Apache.

Technologies in use by Ppmpharma.net

Technology

Number of occurences: 2
  • Html
  • Javascript

Advertisement

Server Type

  • Apache

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Ppmpharma.net

Missing HTTPS protocol.

    Meta - Ppmpharma.net

    Number of occurences: 0

    Server / Hosting

    • IP: 212.227.247.78
    • Latitude: 51.30
    • Longitude: 9.49
    • Country: Germany

    Rname

    • ns-fr.1and1-dns.org
    • ns-fr.1and1-dns.biz
    • ns-fr.1and1-dns.com
    • ns-fr.1and1-dns.fr
    • mx01.1and1.fr
    • mx00.1and1.fr

    Target

    • hostmaster.1and1.com

    HTTP Header Response

    HTTP/1.1 200 OK Content-Type: text/html Content-Length: 499 Date: Sat, 03 Sep 2016 08:46:40 GMT Server: Apache Last-Modified: Tue, 03 Mar 2015 02:16:33 GMT ETag: "60b10410-1f3-51058ec6fc41c" Accept-Ranges: bytes X-Cache: MISS from s_wx1123 X-Cache-Lookup: MISS from s_wx1123:80 Via: 1.1 s_wx1123 (squid/3.5.20) Connection: keep-alive

    DNS

    host: ppmpharma.net
    1. class: IN
    2. ttl: 3600
    3. type: A
    4. ip: 212.227.247.78
    host: ppmpharma.net
    1. class: IN
    2. ttl: 172800
    3. type: NS
    4. target: ns-fr.1and1-dns.org
    host: ppmpharma.net
    1. class: IN
    2. ttl: 172800
    3. type: NS
    4. target: ns-fr.1and1-dns.biz
    host: ppmpharma.net
    1. class: IN
    2. ttl: 172800
    3. type: NS
    4. target: ns-fr.1and1-dns.com
    host: ppmpharma.net
    1. class: IN
    2. ttl: 172800
    3. type: NS
    4. target: ns-fr.1and1-dns.fr
    host: ppmpharma.net
    1. class: IN
    2. ttl: 86400
    3. type: SOA
    4. mname: ns-fr.1and1-dns.fr
    5. rname: hostmaster.1and1.com
    6. serial: 2016031500
    7. refresh: 28800
    8. retry: 7200
    9. expire: 604800
    10. minimum-ttl: 1800
    host: ppmpharma.net
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 10
    5. target: mx01.1and1.fr
    host: ppmpharma.net
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 10
    5. target: mx00.1and1.fr
    host: ppmpharma.net
    1. class: IN
    2. ttl: 3600
    3. type: AAAA
    4. ipv6: 2001:8d8:1000:f2e1:ca3f:823d:da57:f82a

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.pmpharma.net, www.pipmpharma.net, www.ipmpharma.net, www.pkpmpharma.net, www.kpmpharma.net, www.pupmpharma.net, www.upmpharma.net, www.pjpmpharma.net, www.jpmpharma.net, www.plpmpharma.net, www.lpmpharma.net, www.pmpharma.net, www.ppimpharma.net, www.pimpharma.net, www.ppkmpharma.net, www.pkmpharma.net, www.ppumpharma.net, www.pumpharma.net, www.ppjmpharma.net, www.pjmpharma.net, www.pplmpharma.net, www.plmpharma.net, www.pppharma.net, www.ppmppharma.net, www.ppppharma.net, www.ppmopharma.net, www.ppopharma.net, www.ppmipharma.net, www.ppipharma.net, www.ppmkpharma.net, www.ppkpharma.net, www.ppm.pharma.net, www.pp.pharma.net, www.ppmupharma.net, www.ppupharma.net, www.ppmjpharma.net, www.ppjpharma.net, www.ppmnpharma.net, www.ppnpharma.net, www.ppm-pharma.net, www.pp-pharma.net, www.ppmharma.net, www.ppmpiharma.net, www.ppmiharma.net, www.ppmpkharma.net, www.ppmkharma.net, www.ppmpuharma.net, www.ppmuharma.net, www.ppmpjharma.net, www.ppmjharma.net, www.ppmplharma.net, www.ppmlharma.net, www.ppmparma.net, www.ppmphearma.net, www.ppmpearma.net, www.ppmphdarma.net, www.ppmpdarma.net, www.ppmphcarma.net, www.ppmpcarma.net, www.ppmphuarma.net, www.ppmpuarma.net, www.ppmphjarma.net, www.ppmpjarma.net, www.ppmpharma.net, www.ppmparma.net, www.ppmphbarma.net, www.ppmpbarma.net, www.ppmphgarma.net, www.ppmpgarma.net, www.ppmphrma.net, www.ppmphaorma.net, www.ppmphorma.net, www.ppmphaprma.net, www.ppmphprma.net, www.ppmpha9rma.net, www.ppmph9rma.net, www.ppmpharma.net, www.ppmphrma.net, www.ppmphairma.net, www.ppmphirma.net, www.ppmphaurma.net, www.ppmphurma.net, www.ppmphama.net, www.ppmpharima.net, www.ppmphaima.net, www.ppmpharoma.net, www.ppmphaoma.net, www.ppmpharlma.net, www.ppmphalma.net, www.ppmpharlma.net, www.ppmphalma.net, www.ppmphar.ma.net, www.ppmpha.ma.net, www.ppmphara.net, www.ppmpharmpa.net, www.ppmpharpa.net, www.ppmpharmoa.net, www.ppmpharoa.net, www.ppmpharmia.net, www.ppmpharia.net, www.ppmpharmka.net, www.ppmpharka.net, www.ppmpharm.a.net, www.ppmphar.a.net, www.ppmpharmua.net, www.ppmpharua.net, www.ppmpharmja.net, www.ppmpharja.net, www.ppmpharmna.net, www.ppmpharna.net, www.ppmpharm-a.net, www.ppmphar-a.net, www.ppmpharm.net, www.ppmpharmao.net, www.ppmpharmo.net, www.ppmpharmap.net, www.ppmpharmp.net, www.ppmpharma9.net, www.ppmpharm9.net, www.ppmpharma.net, www.ppmpharm.net, www.ppmpharmai.net, www.ppmpharmi.net, www.ppmpharmau.net, www.ppmpharmu.net,

    Other websites we recently analyzed

    1. kasimpasalikemalefendivakfi.info | Isimtescil.net | Ücretsiz yapım aşamasında sayfası
      Cyprus - 93.89.226.17
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Html
    2. www.aarhusdesignbureau.dk
      Denmark - 77.66.85.131
      Server software: Apache-Coyote/1.1
      Technology: Html
      Number of meta tags: 1
    3. CNC-Bertschinger AG - Präzisionsmechanik
      Jules Bertschinger AG, Präzisionsmechanik, CNC-Bearbeitung, Werkzeug- und Formenbau
      Switzerland - 217.196.177.100
      Server software: nginx
      Technology: Html, Javascript, jQuery UI, Php, Xoops
      Number of Javascript: 9
      Number of meta tags: 8
    4. Riverside Haj
      Riverside Haj
      San Francisco (United States) - 192.241.212.155
      G Analytics ID: UA-51322866-1
      Server software: nginx/1.4.6 (Ubuntu)
      Technology: Carousel, CSS, Html, Html5, Iframe, Javascript, jQuery, Google Analytics
      Number of Javascript: 13
      Number of meta tags: 5
    5. www.newrf.ru/ - Сервис регистрации доменов и хостинга *.RU-TLD.RU
      France - 37.187.83.72
      Server software: nginx
      Technology: CSS, Google Font API, Html, Javascript, Shortcodes, Yandex.Metrika, Wordpress
      Number of Javascript: 1
      Number of meta tags: 1
    6. Campus-Management von CampusCore
      Germany - 217.194.229.17
      Server software: Apache/2.2.0 (Fedora)
      Technology: Carousel, CSS, Google Font API, Html, Html5, jQuery Cycle
      Number of Javascript: 10
      Number of meta tags: 1
    7. Liikelahjat | mainoslahjat | mainostekstiilit | - Matin Sakki
      Liikelahjat,mainoslahjat sekä mainostekstiilit 30 vuoden kokemuksella. Tehtävämme on auttaa sinua rakentamaan kestäviä asiakassuhteita.
      Finland - 84.34.147.48
      Server software: Apache/2
      Technology: CSS, Google Font API, Html, Javascript, Php, Google Analytics, Prestashop
      Number of Javascript: 25
      Number of meta tags: 7
    8. Park iwestycyjny kopytkowo
      Park Inwestycyjny Kopytkowo to tereny inwestycyjne położone w gminie Smętowo Graniczne, w powiecie starogardzkim, w województwie pomorskim, przy węźle autostradowym Kopytkowo autostrady A1
      Poland - 89.161.129.57
      Server software: IdeaWebServer/v0.80
      Technology: CSS, Html, Html5, Javascript, SVG
      Number of Javascript: 4
      Number of meta tags: 4
    9. MDU Dev
      France - 62.4.19.110
      Server software: nginx
      Technology: CSS, Google Font API, Html, Html5, Javascript, jQuery, Php, Pingback, Wordpress
      Number of Javascript: 3
      Number of meta tags: 3
    10. Fresh Encounter Church | Atlanta, GA
      Houston (United States) - 108.167.135.122
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Google Font API, Html, Html5, Javascript
      Number of Javascript: 6
      Number of meta tags: 2

    Check Other Websites